🔥 LABOR DAY SALE — Buy 3, Get 2 Free · Buy 2, Get 1 Free · Buy 1, Get 1 50% Off (auto-applies in your cart) — ends in --
CoA With Every Order US-Based Dispatch · FedEx Express Secure Encrypted Checkout 30+ Research Compounds In Stock For Research Use Only
My Cart

Researcher Verification

Zama Biosciences sells research peptides exclusively to qualified researchers and laboratories for in vitro and laboratory use. Please confirm before continuing.

I am at least 21 years of age.

Enter Zama Biosciences

By proceeding you affirm the statements above are true. Products are not for human or veterinary use, not for use in diagnostic procedures, and have not been evaluated by the U.S. Food and Drug Administration. Full disclaimer.

Enter your email and receive 20% discount! 🚀

Not a researcher? Exit

All Products > IGF-1 / IGF-1 LR3 0.1mg
IGF-1 LR3 0.1mg lyophilized research peptide vial with Zama Biosciences label, research use only
Peptides

IGF-1 / IGF-1 LR3 0.1mg

Growth Factor & Anti-Aging
View Certificate of Analysis
$76.00
10 Available

Dosage

10 in stock

1

FedEx Express

HPLC Verified

Secure checkout

Same-day shipping

Technical specs

The data your labnotebook needs

Pulled from the verification packet included with each shipment. Cross-check the batch ID on your vial against the COA.

Molecular weight

9117.5 g/mol (LR3) | 7649 Da (native IGF-1)

Purity

99.48%

CAS number

946870-92-4 (IGF-1 LR3) — NOTE: product name mixes two different peptides, see note

Storage

−20°C, protect from light

Form

White lyophilized powder

Solubility

Soluble in dilute acetic acid / sterile water

Batch number

CR-3XAG-37-2606-30

Sequence

IGF-1 LR3: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Molecular formula

IGF-1 LR3: C400H625N111O115S9 | native IGF-1: C331H512N94O101S7

Receptor activity

IGF-1 receptor agonist; studied in PI3K/Akt and MAPK signalling, cellular proliferation and protein synthesis. LR3 variant has reduced IGFBP binding affinity.

You may also like…

FAQ

researchersask before ordering

How quickly will I receive a response?

We typically respond to all email inquiries within 24 hours on business days (Monday-Friday, 9am-6pm EST). For urgent order issues, please include your order number in the subject line for priority handling.

Once your order ships, you’ll receive a confirmation email with tracking information. You can also check your order status by emailing info@zamabio.com with your order number. Orders are processed within 0-2 business days, with most arriving within 3-5 business days from fulfillment. Every order includes free shipment protection.

We’re sorry to hear that! Please email info@zamabio.com immediately with your order number and photos of the damage. Photo evidence is required for all claims. Once verified, we’ll send a one-time replacement within 24 hours at no cost. One replacement per customer per order, subject to review.

Every order includes a batch-specific Certificate of Analysis (CoA) verifying purity, identity, and quality. You can also access CoAs on each product page. If you have questions about a specific CoA or need additional documentation, our support team is happy to help at info@zamabio.com.

While we cannot provide medical or therapeutic advice, our team can help you understand the specifications, purity levels, and research applications of our peptides. Email us with details about your research focus, and we’ll point you toward relevant product information and published studies.

Every order includes access to batch-specific Certificates of Analysis. CoAs are available on each product page and are also included in your order confirmation email. If you need a specific CoA or have questions about lab results, email us with your order number and we’ll send it right over.

Payment declines can occur for several reasons. First, ensure your billing address matches your card exactly. If issues persist, try a different payment method or contact your bank to authorize the transaction. You can also email us and we’ll help troubleshoot or provide alternative payment options.

Let us notify you when it's available We will inform you when the product arrives in stock. Please leave your valid email address below.